General Information

  • ID:  hor004643
  • Uniprot ID:  Q3ECD6
  • Protein name:  CLE1p
  • Gene name:  CLE1
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE1p]: Mostly expressed in roots and seedlings, and, to a lower extent, in stems and apex.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  RLSPGGPDPRHH
  • Length:  12
  • Propeptide:  MANLKFLLCLFLICVSLSRSSASRPMFPNADGIKRGRMMIEAEEVLKASMEKLMERGFNESMRLSPGGPDPRHH
  • Signal peptide:  MANLKFLLCLFLICVSLSRSSA
  • Modification:  T4 Hydroxyproline;T7 Hydroxyproline
  • Glycosylation:  T7 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  1-1R->K,N: No impact on proteolysis.

Activity

  • Function:  Extracellular signal peptide that regulates cell fate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q3ECD6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004643_AF2.pdbhor004643_ESM.pdb

Physical Information

Mass: 152183 Formula: C56H88N22O16
Absent amino acids: ACEFIKMNQTVWY Common amino acids: P
pI: 10.4 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 1
Hydrophobicity: -179.17 Boman Index: -4448
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 32.5
Instability Index: 5955 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16407446
  • Title:  Evidence for Functional Conservation, Sufficiency, and Proteolytic Processing of the CLAVATA3 CLE Domain